FOXO4-DRI
A mirror-image peptide that pries p53 away from FOXO4 inside senescent cells, forcing the zombie cells that accumulate with age to finally undergo apoptosis.
Also known as FOXO4 D-Retro-Inverso peptide, FOXO4-DRI senolytic, Proxofim
Animal data only — Rodent or other animal studies. Dose translation to humans is genuinely uncertain.
One landmark mouse study in Cell (Baar et al. 2017) plus follow-up preclinical work. No human trial, no human pharmacokinetics, no human safety data whatsoever. Among the compounds on this site, FOXO4-DRI has one of the widest gaps between how impressive the animal result is and how little is known about using it in a person.
How it works
Senescent cells survive despite heavy DNA damage because FOXO4, which is highly expressed in senescence, sequesters p53 in nuclear foci and keeps it from executing apoptosis. FOXO4-DRI is a peptide covering the FOXO4 region that binds p53, built entirely from D-amino acids in reverse sequence — a retro-inverso design that preserves the side-chain topology while making the molecule essentially invisible to proteases. It outcompetes endogenous FOXO4 for p53, p53 relocates to the mitochondria, and the senescent cell dies. Healthy cells, which have little FOXO4-p53 sequestration to begin with, are largely spared. In Baar's 2017 Cell paper, aged and progeroid mice given the peptide regrew fur, recovered renal function and improved running endurance. This is genuinely one of the most striking single results in ageing biology — and it has never been tested in a human being.
Targets: FOXO4, p53, Senescent cell apoptosis, p21/senescence-associated secretory phenotype
Dosing
| Protocol | Dose | Frequency | Route |
|---|---|---|---|
| Published mouse protocol (the actual evidence)n/a | — | three times weekly on alternating days for about three weeks | intravenous |
| Grey-market human protocol (unvalidated)Morning. | 1 mg – 5 mg | once daily for three consecutive days, repeated every few months | subcutaneous |
- · Baar et al. 2017 used 5 mg/kg IV in mice. Naive body-weight scaling from mouse to human is not valid here, and the human-equivalent conversion people quote is a guess.
- · Senolytics are given as brief hit-and-run pulses, not continuously, because they kill a cell population rather than modulating a pathway. Everything about the human dose here is invented by the community — treat it as such.
Cycling
Pulsed by design. A short burst of 3-5 days, then months off — long enough for the senescent burden to rebuild before there is any point in dosing again. Continuous senolytic dosing makes no biological sense and increases whatever the unknown risks are.
Pharmacology
- Half-life
- Deliberately protease-resistant because of the all-D backbone, so it persists far longer than a normal 43-mer, but no human pharmacokinetic data exist.
- Onset
- In mice, fur density and renal markers changed over roughly three weeks of intermittent dosing. There is no human time course.
- Routes
- intravenous, subcutaneous
- Molecule
- D-retro-inverso peptide, 43 residues, with a cell-penetrating segment
- Sequence length
- 43 amino acids
Handling
- Diluent
- Bacteriostatic water
- Typical mix
- 2 or 3 mL
- Vial sizes
- 5, 10 mg
- Lyophilised
- Freezer. This is an expensive peptide and there is no reason to store it warm.
- Reconstituted
- Refrigerated, use within a couple of weeks; ideally reconstitute only what a single pulse needs.
- Light sensitive
- Yes — keep it out of the light
Mixing
Highly cationic and can adsorb to plastic; some users prefer glass syringes for the same reason. Dissolve gently.
Side effects
- commonInjection-site reaction
- commonFlu-like malaise during the dosing pulse— Anecdotally reported and mechanistically plausible — clearing a large cell population releases inflammatory debris.
- uncommonTransient elevated inflammatory markers
- rareUnknown risk from off-target p53 activation— The selectivity margin has never been characterised in humans. This is the real reason to be cautious.
Do not use if
- Any active malignancy or recent chemotherapy — the interaction between a p53-releasing senolytic and a tumour is completely uncharacterised.
- Autoimmune disease in flare — the inflammatory clearance burst is a bad match.
- Pregnancy and breastfeeding — absolutely no data.
- Anyone under roughly 40 with no meaningful senescent burden to clear; you are taking all of the unknown risk for none of the theoretical benefit.
Combining it
- redundantdasatinib-quercetin — The other main senolytic protocol; running both in the same window doubles the clearance burden with no added rationale.
- synergynad-plus — Commonly sequenced afterwards on the theory that regeneration follows clearance — plausible narrative, no evidence.
What to monitor
- · CBC and CRP around a pulse, given the clearance-inflammation risk.
- · Renal and liver panels before and after, since these were the tissues that changed in mice.
- · There is no clinically available senescence biomarker you can actually track, which is a real limitation of using this compound at all.
Legal status
Not approved anywhere; sold strictly as a research chemical.
References
- Baar et al. 2017, Cell — targeted apoptosis of senescent cells restores tissue homeostasis in response to chemotoxicity and ageing (preclinical)
- Kirkland & Tchkonia, review of senolytic drugs and their translation (review)
Mechanism in depth
Senescent cells are not quiescent — they are cells that have accumulated enough damage that p53 should have killed them, and did not. FOXO4 is upregulated in senescence and sequesters p53 into nuclear foci, physically preventing it from reaching the mitochondria to execute the intrinsic apoptosis programme. That sequestration is why senescent cells persist for years, pumping out the senescence-associated secretory phenotype. FOXO4-DRI is the interface peptide: it presents the FOXO4 surface that binds p53, outcompetes endogenous FOXO4, and releases p53, which then relocates to the mitochondria and kills the cell. A 2025 Nature Communications structural study from Bourgeois and colleagues pinned down what it actually engages — the disordered transactivation domain of p53, not a folded pocket — which explains both why the interaction is hard to drug with a small molecule and why a peptide works. The selectivity argument is elegant: a healthy cell has little FOXO4-p53 sequestration to disrupt, so releasing p53 there does nothing, whereas a senescent cell has a loaded gun that FOXO4 is holding back. In practice the selectivity margin has never been characterised in a human. The mouse result in Baar 2017 remains one of the most striking single experiments in ageing biology — aged and progeroid animals given intermittent peptide regrew fur, recovered renal function markers and improved running endurance — and it has been extended since into keloid fibroblasts, endothelial senescence, glioblastoma chemosensitisation and brain-ageing models. Every one of those is preclinical. The clinical shape of a senolytic is also different from anything else on this site: it is hit-and-run. You are killing a cell population, not modulating a pathway, so the dosing is a brief pulse and then months of nothing while the burden rebuilds. Continuous dosing is not a more aggressive version of the protocol, it is a mechanistically incoherent one.
What usually goes wrong
Start with the honest framing: no human has taken this in a published study, there is no human pharmacokinetics, no human safety data, and no human dose. Every number in circulation for human use was invented by the community. The specific failure modes follow from that. First, people scale the mouse dose naively. Baar used 5 mg/kg intravenously in mice; body-weight scaling from mouse to human overestimates the human dose by roughly twelvefold if you do it naively, and nobody has done the allometry properly for a protease-resistant cationic peptide anyway. Second, people run it continuously or monthly. Senolytics are hit-and-run by design — a short burst, then long enough for the senescent burden to actually rebuild, which is months. Frequent dosing gives you all the risk of off-target p53 activation with none of the biological logic. Third, the clearance burst is real and underestimated: flu-like malaise during a pulse is commonly reported and mechanistically expected, and in someone with a high senescent burden it can be genuinely unpleasant. Fourth, people under 40 run it. If you do not have a meaningful senescent cell population to clear, you are taking every unknown risk in exchange for nothing. Fifth, and most importantly: there is no clinically available senescence biomarker. You cannot measure your senescent burden before dosing and you cannot measure whether you reduced it. That is a fundamental limitation of using this compound at all, and it should factor into the decision rather than being discovered afterwards.
Bloodwork worth running
| Marker | When | Why it matters |
|---|---|---|
| hs-CRP and, if accessible, IL-6 | Baseline, 48-72 hours after the last dose of a pulse (expect a rise), and again at 4-6 weeks (this is where you would hope to see a fall below baseline). | Senolysis is supposed to reduce chronic inflammatory signalling by removing the cells producing it, but the act of clearing a large cell population transiently increases it. Both directions matter and they happen at different times.Act if: hs-CRP still elevated above your own baseline at 4-6 weeks post-pulse means the clearance-inflammation has not resolved, and that is a reason to investigate rather than to dose again. |
| Comprehensive metabolic panel — creatinine, eGFR, ALT, AST, bilirubin | Baseline, 72 hours after a pulse, and at 4 weeks. | Kidney and liver were the tissues that visibly recovered in the Baar mouse work, and they are also the organs where a large apoptotic burden and the resulting debris load shows up. You want both the safety read and the potential benefit read from the same panel.Act if: Creatinine rising more than 25% from baseline, or transaminases above three times the upper reference limit — do not run another pulse, and get it worked up. |
| CBC with differential | Baseline, one week after a pulse, and at four weeks. | A systemic pro-apoptotic agent with an uncharacterised selectivity margin can plausibly hit proliferating compartments. The bone marrow is the fastest-turning-over tissue you have and the first place off-target killing would show.Act if: Any new cytopenia — neutrophils, platelets or haemoglobin dropping outside your own baseline range — stop, and do not run further pulses until it has resolved and been explained. |
| Uric acid and LDH | Baseline and 48-72 hours after the final dose of a pulse. | Both are crude markers of cell turnover and lysis. If you are killing a meaningful cell population, they should register, and if they do not register at all that is weak evidence you are not achieving anything pharmacologically.Act if: A large rise alongside renal impairment is a tumour-lysis-like picture and needs immediate medical attention, not a forum post. |
Pharmacokinetics
- Metabolism
- Minimal proteolysis by design. The D-amino acid retro-inverso construction exists specifically to defeat peptidases, which is also why nobody can tell you how the compound is eventually eliminated.
- Elimination
- Unknown. Presumed renal filtration of intact peptide, but the strong cationic charge promotes tissue and membrane association, which complicates that assumption.
Receptor targets
- p53 transactivation domain (intrinsically disordered region) — Binding to the disordered p53 TAD characterised structurally in 2025; no single consensus Kd applicable across constructs.
Competitive displacement of endogenous FOXO4 from p53, releasing p53 from nuclear foci. This is the entire mechanism.
- FOXO4 (competitive antagonism at the p53 interface) — Not a direct FOXO4 binder — it mimics FOXO4 and competes for the shared p53 site.
Loss of FOXO4-mediated p53 sequestration in senescent cells.
- Mitochondrial p53 apoptosis pathway (downstream) — Not applicable.
Released p53 relocates to mitochondria and triggers intrinsic apoptosis. In keloid fibroblasts the mechanism was shown to involve nuclear exclusion of p53 phosphorylated at serine 15.
- Senescence-associated secretory phenotype (downstream consequence) — Not applicable.
Clearance of the SASP-producing cell population, which is the actual therapeutic goal — the SASP is what drives the inflammatory damage, not the senescent cell's own presence.
What to expect, and when
Hours to days into a pulse: flu-like malaise, mild fever feeling, general rubbishness — anecdotal but mechanistically expected from clearing a cell population and releasing its contents. Days two to five: inflammatory markers peak, if you are measuring them. Weeks one to three: this is the window in which the mouse phenotypes changed — fur density, renal markers, running endurance — after roughly three weeks of intermittent dosing. Whether anything analogous happens in a human on any timescale is entirely unknown. Months: the senescent cell burden rebuilds, which is the argument for spacing pulses months apart rather than weeks. Nobody has measured the rebuild rate in a human either.
Stacking and comparisons
The sequencing logic people use is clear-out-then-rebuild: a FOXO4-DRI pulse, then NAD+ or a regenerative protocol in the weeks afterward, on the theory that you have made room for tissue repair. It is a nice narrative and there is no evidence for it. What matters more is what not to combine. Do not run FOXO4-DRI in the same window as dasatinib plus quercetin or any other senolytic — you are targeting the same finite cell population by two mechanisms simultaneously, which doubles the clearance burden and the inflammatory response without any rationale for doubling the kill. Do not run it during an autoimmune flare; the clearance burst is an inflammatory event and you are already inflamed. Do not run it alongside chemotherapy without oncology input — senolytics are being studied precisely as chemotherapy adjuncts, which means the interaction is real and consequential rather than absent, and getting the timing wrong in either direction is plausible. Anything anti-apoptotic in your stack — humanin, SHLP-2 — is directly antagonistic to what FOXO4-DRI is trying to do, and running them concurrently is incoherent.
Against dasatinib plus quercetin: D+Q is the other main senolytic protocol and it is substantially further along — dasatinib is an approved drug with known human pharmacokinetics and a known toxicity profile, and D+Q has actually been given to humans in small pilot trials in idiopathic pulmonary fibrosis and diabetic kidney disease. FOXO4-DRI has never been given to a human in a published study. On evidence for human use, D+Q wins clearly. On elegance of mechanism and selectivity in theory, FOXO4-DRI wins clearly. Those are not the same axis and you should be clear which one you are optimising. Against fisetin: fisetin is cheap, oral, has a benign safety profile and weak senolytic evidence. Against everything else in this class: FOXO4-DRI has the widest gap on the entire site between how impressive the animal result is and how little is known about using it in a person. That gap is the compound's defining feature and it should drive the decision.
Rough cost
$200–$800/month. Not verified against live pricing this session. FOXO4-DRI is expensive to synthesise — 46 residues, every one a D-amino acid, made by solid-phase synthesis — and it is one of the priciest peptides per milligram on the grey market. The per-month framing is misleading because the protocol is a three-to-five-day pulse every few months; the honest figure is cost per pulse, which for a 1-5 mg daily dose over three days is roughly 3-15 mg of peptide. Suspiciously cheap product should be treated as a red flag, because a full D-amino acid 46-mer is not cheap to make correctly.
Genuinely uncertain
- The Core record gives 43 residues; the sequence I verified in the Baar 2017 full text and in independent replications is 46 residues (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG). I could not reconcile the discrepancy and the 46-residue figure is the one supported by the literature I checked.
- No pharmacokinetic data exist in any species. Half-life, tmax, distribution, elimination route and blood-brain barrier penetration are all unknown.
- No human has been dosed in any published study. There is no human safety data and no established dose.
- The selectivity margin between senescent and healthy cells has never been quantified in a whole animal, let alone a human.
- The mouse-to-human dose conversion people quote is not derived from any published allometric analysis I could find.
- Subcutaneous bioavailability of a highly cationic 46-mer is unmeasured, and the published efficacy work used the intravenous route.
- No clinically available biomarker of senescent cell burden exists, so neither dosing nor response can be objectively guided.
- Whether the flu-like malaise reported by users is genuinely a clearance reaction, an immune response to the peptide, or an endotoxin problem from unregulated product has never been distinguished.
- Cost figures are estimates and were not verified against live vendor pricing.
- Molecular weight is not stated in the Core record and I did not resolve a published value; it is not calculated here to avoid presenting arithmetic as a sourced figure.
Papers
- Targeted apoptosis of senescent cells restores tissue homeostasis in response to chemotoxicity and aging Baar MP, Brandt RMC, Putavet DA, Klein JDD, Derks KWJ, Bourgeois BRM, Stryeck S, Rijksen Y, van Willigenburg H, Feijtel DA, van der Pluijm I, Essers J, van Cappellen WA, van IJcken WF, Houtsmuller AB, Pothof J, de Bruin RWF, Madl T, Hoeijmakers JHJ, Campisi J, de Keizer PLJ, Cell, 2017 · PMID 28340339
The landmark paper and the entire evidence base for the compound as a geroprotector. Aged and progeroid mice, intermittent intravenous dosing at 5 mg/kg, restored fur density, renal function and running endurance. Full-text search confirms the peptide sequence given in this record.
- The disordered p53 transactivation domain is the target of FOXO4 and FOXO4-DRI Bourgeois B, et al., Nature Communications, 2025 · PMID 40593617
The structural mechanism — FOXO4-DRI engages the intrinsically disordered p53 transactivation domain. This is the paper that turned the mechanism from a plausible model into characterised biophysics.
- FOXO4-DRI induces keloid senescent fibroblast apoptosis by promoting nuclear exclusion of upregulated p53-serine 15 phosphorylation Kong YX, Li ZS, Liu YB, Pan B, Fu X, Xiao R, Yan L, Communications Biology, 2025 · PMID 39994346
An independent application showing the mechanism operating in human keloid fibroblasts, with the p53-Ser15 nuclear exclusion detail. Also independently reports the peptide sequence.
- FOXO4-DRI regulates endothelial cell senescence via the p53 signaling pathway Hu Z, et al., Frontiers in Bioengineering and Biotechnology, 2025 · PMID 41625068
Vascular senescence application — relevant because vascular ageing is one of the main reasons people are interested in senolytics.
- Targeting the FOXO4-p53 axis by retro-inverso peptide senolytic agents Alameen AAM, et al., Naunyn-Schmiedeberg's Archives of Pharmacology, 2026 · PMID 42024235
Current review of the retro-inverso senolytic class including brain-ageing applications. Useful for seeing how far the preclinical literature has extended since 2017 — and how it still has not reached a human.