Skip to content
PeptideAI
Approved drugfat losscognitionlongevityhormone support

Tesamorelin

The only FDA-approved GHRH analogue, a stabilised full-length GHRH(1-44) that specifically strips visceral abdominal fat without the appetite or glucose penalties of most fat-loss drugs.

Also known as TH9507, trans-3-hexenoyl-GRF(1-44), Tesamorelin acetate, Egrifta, Egrifta SV, Egrifta WR, TH9507

Approved drugLicensed by a major regulator for human use, with phase-3 trial data behind it.

Two phase 3 randomised placebo-controlled trials in HIV-associated lipodystrophy showed roughly 15 to 18 percent reduction in visceral adipose tissue at 26 weeks, which is the basis of the FDA approval. Evidence outside that population - general obesity, NAFLD, cognition - is limited to smaller investigator-led trials that are promising but not registrational.

How it works

Tesamorelin is human GHRH(1-44) with a trans-3-hexenoyl group attached to the N-terminal tyrosine, which blocks DPP-4 cleavage and extends the effective half-life while preserving full GHRH-receptor activity. Because the resulting GH release remains pulsatile and under normal negative feedback, IGF-1 rises but stays largely within physiological range. Visceral adipose tissue is unusually rich in GH receptors and lipolytically responsive, which is why the fat loss is regionally selective rather than general: registration trials showed roughly 15 to 18 percent reduction in visceral adipose tissue at 26 weeks with little change in subcutaneous fat. There is also good evidence for reduced liver fat, and separate work has examined it in mild cognitive impairment on the basis that GHRH raises brain GABA and improves executive function in older adults.

Targets: GHRH receptor (GHRHR), Visceral adipose tissue lipolysis, IGF-1 axis, Hepatic fat

Dosing

ProtocolDoseFrequencyRoute
Egrifta original formulation (label dose)Rotating abdominal sites, any consistent time of day.2 mgonce dailysubcutaneous
Egrifta SV (F4 formulation)Daily, abdomen, rotating sites.1.4 mgonce dailysubcutaneous
Egrifta WR (F8 formulation, approved 2025)Daily injection, but the vial is reconstituted only once a week.1.28 mgonce dailysubcutaneous
Off-label body-composition useUsually at bedtime, fasted.1 mg – 2 mgonce dailysubcutaneous
  • · The dose used in the phase 3 trials: 2 mg daily, reconstituted from two 1 mg vials.
  • · 1.4 mg daily from a single 2 mg vial. Bioequivalent exposure to the original 2 mg dose.
  • · 1.28 mg daily. The formulations are explicitly not interchangeable - vial count, reconstitution and storage all differ.
  • · Grey-market users commonly run 1 to 2 mg nightly for 12 to 26 weeks. Anything below about 1 mg has no trial support for the visceral-fat effect.

Titration

No titration in the label; the dose is fixed. Some clinicians start at half dose for two weeks if fluid retention or arthralgia is a concern.

Cycling

The registration data run 26 weeks with a 26-week extension, and visceral fat returns after discontinuation, so this is a maintenance drug rather than a cycle. Off-label users typically run 12 to 26 weeks and reassess with imaging or waist circumference.

Work out your exact syringe units →

Pharmacology

Half-life
About 26 to 38 minutes subcutaneously, longer in people with HIV than in healthy volunteers.
Onset
Visceral fat reduction is measurable by 12 weeks and near-maximal at 26 weeks; it reverses within roughly 6 months of stopping.
Routes
subcutaneous
Molecule
Stabilised synthetic GHRH(1-44) analogue with an N-terminal hexenoyl group
Sequence length
44 amino acids
Molecular weight
5135.9 Da

Handling

Diluent
Sterile water for injection (supplied), not bacteriostatic water for the branded product
Typical mix
1 or 2 mL
Vial sizes
1, 2 mg
Lyophilised
Egrifta SV is stored at room temperature; the original Egrifta and Egrifta WR have their own requirements. Generic lyophilised tesamorelin should be refrigerated or frozen.
Reconstituted
Use immediately for the original formulation; Egrifta WR is designed for weekly reconstitution with refrigerated storage between daily doses.
Light sensitive
Yes — keep it out of the light

Mixing

Branded Egrifta comes with its own diluent and a formulation-specific procedure - follow the carton, not a generic peptide guide. Grey-market tesamorelin is usually reconstituted with 2 mL bacteriostatic water in a 10 mg vial, giving 5000 mcg/mL.

Side effects

  • very commonInjection-site erythema, pruritus, pain or rashThe most common adverse event in the trials; rotate abdominal sites.
  • commonArthralgia and joint stiffnessDose-related GH effect.
  • commonPeripheral oedema
  • commonMyalgia and muscle stiffness
  • commonParaesthesia and hypoaesthesiaOften the first sign of fluid-driven nerve compression.
  • uncommonIncreased glucose and new-onset or worsened diabetesA labelled warning; glucose should be checked before and during treatment.
  • uncommonCarpal tunnel syndrome
  • uncommonHypersensitivity reactions including rash and urticariaAnti-tesamorelin IgG antibodies were detected in about 50 percent of patients at 26 weeks and 47 percent at 52 weeks in the registration trials, without demonstrated loss of efficacy; roughly half of those cross-reacted with endogenous GRF. Frank hypersensitivity reactions are much less common.

Do not use if

  • Disruption of the hypothalamic-pituitary axis from hypophysectomy, pituitary tumour or surgery, head irradiation or head trauma.
  • Active malignancy - the label explicitly requires that any active cancer be resolved first.
  • Pregnancy, since it offers no benefit and could impair glucose tolerance.
  • Known hypersensitivity to tesamorelin or mannitol.

Combining it

  • cautionCorticosteroidsGH alters 11-beta-HSD-1 activity, so patients on cortisone or prednisone may need dose adjustment; the label calls this out specifically.
  • cautionCytochrome P450 substratesGH can suppress CYP-mediated metabolism, which matters for narrow-therapeutic-index drugs.
  • cautioninsulinExpect increased insulin requirements in diabetics.
  • synergysemaglutideA popular off-label pairing: GLP-1 for total mass, tesamorelin for the visceral compartment. No trial data on the combination.

What to monitor

  • · Fasting glucose and HbA1c at baseline and periodically - this is a labelled requirement, not a nicety.
  • · IGF-1 at baseline and every 6 to 12 months; sustained levels above the age-adjusted range warrant a dose review.
  • · Waist circumference or, ideally, a CT/MRI visceral fat measurement at baseline and 26 weeks.
  • · Clinical surveillance for malignancy, per the label.

Legal status

FDA-approved (Egrifta 2010, Egrifta SV, Egrifta WR 2025) for reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. Prescription-only; all other uses are off-label. Prohibited in sport under WADA S2.

References

  • Falutz et al. 2007 NEJM, tesamorelin phase 3 in HIV-associated abdominal fat accumulation (trial)
  • Egrifta SV and Egrifta WR FDA prescribing information (label)
  • Stanley et al., tesamorelin and hepatic fat in HIV-associated NAFLD (trial)

Mechanism in depth

The sequence was verified directly against UniProt P01286: mature human GHRH is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, 44 residues, and tesamorelin is that with a hexenoyl cap on the N-terminus. Two things follow. First, this is the full-length hormone rather than the minimal active fragment, so it carries whatever stability and receptor-interaction contribution residues 30 to 44 provide. Second, the single N-terminal acylation is doing all the pharmacokinetic work, and it is a remarkably economical piece of chemistry - one modification instead of the four in Mod GRF 1-29. The regional selectivity of the fat loss is the interesting part and it is not marketing. Visceral adipose tissue expresses GH receptor more densely than subcutaneous fat and is more lipolytically responsive to GH; GH activates hormone-sensitive lipase and adipose triglyceride lipase through a route that suppresses the antilipolytic action of insulin. Because portal drainage delivers visceral lipolysis products straight to the liver, mobilising that compartment also reduces hepatic fat, which is exactly what Stanley's Lancet HIV trial found - a randomised, double-blind, placebo-controlled demonstration of reduced liver fat in HIV-associated NAFLD, with a follow-up transcriptomic analysis showing downregulation of hepatic fibrosis and inflammation gene sets. That is a genuinely unusual level of mechanistic corroboration for anything in this class. Because release remains pulsatile and IGF-1 feedback remains intact, IGF-1 stays largely within physiological range - the visceral fat effect is achieved without the supraphysiological IGF-1 that a DAC-conjugated GHRH analogue produces. The separate cognition work rests on a different observation: GHRH administration raises brain GABA levels and improved executive function in older adults and in mild cognitive impairment in Baker's controlled trial, an effect that appears to be GHRH-driven rather than simply GH-driven.

What usually goes wrong

The most consequential error is treating the three branded formulations as interchangeable. EGRIFTA at 2 mg, EGRIFTA SV at 1.4 mg and EGRIFTA WR at 1.28 mg deliver bioequivalent exposure through different vial counts, different reconstitution procedures and different storage rules - and the label states explicitly that they are not interchangeable. Reading a generic peptide guide instead of the specific carton is how people end up dosing wrong. Second, the glucose warning is real and is where this compound actually hurts people. Someone with prediabetes who starts tesamorelin for visceral fat and does not check HbA1c can convert to frank diabetes while congratulating themselves on their waistline. Third, the effect reverses. Visceral fat returns within roughly six months of stopping, so the mental model of a 12-week cycle producing a permanent change is wrong - this is maintenance therapy or it is nothing. Fourth, on the grey market, dose is the problem: 1 to 2 mg daily is a lot of peptide, it is expensive, and low-dose protocols at 500 mcg have no trial support whatsoever for the visceral effect. Fifth, immunogenicity is worth knowing about: anti-tesamorelin IgG antibodies appeared in 50 percent of patients at 26 weeks and 47 percent at 52 weeks in the registration trials, with roughly 60 percent of those cross-reacting with endogenous GHRH. Efficacy was not demonstrably lost, but 85 percent of the patients who had hypersensitivity reactions had antibodies.

Titration ladder

  1. 1.4 mgLabel - no titration — EGRIFTA SV is 1.4 mg daily from a single 2 mg vial, and EGRIFTA WR is 1.28 mg daily. The label does not titrate; the dose is fixed and the trials used a fixed dose. This is unusual in this class and worth respecting.
  2. 1 mgOff-label soft start, weeks 1 to 2 — Some clinicians start around 1 mg for a fortnight when arthralgia or fluid retention is a concern, then move to full dose. There is no trial support for this, but it costs nothing and the side effects that make people quit are front-loaded.
  3. 2 mgWeek 3 onward — 2 mg daily is the original EGRIFTA phase 3 dose and the one every efficacy number comes from. Anything below about 1 mg has no trial support for the visceral-fat effect at all, which is worth knowing before buying a cheap low-dose protocol.

Bloodwork worth running

MarkerWhenWhy it matters
Fasting glucose and HbA1cBaseline before the first dose, then periodically - practically, at 12 weeks and 26 weeks, and every six months on maintenance.This is a labelled requirement, not a suggestion. Tesamorelin measurably worsens glycaemic control in some patients and the label carries a warning about new-onset or worsened diabetes. It is the single most important test on this compound.Act if: A rise into the prediabetic range (fasting glucose 100 to 125 mg/dL, HbA1c 5.7 to 6.4 percent) warrants a serious conversation about whether the visceral fat benefit is worth it. Frank diabetes developing on treatment is a stop.
IGF-1Baseline and every 6 to 12 months per the label; practically, at 12 weeks on an off-label protocol.Because feedback is intact, IGF-1 on tesamorelin usually stays in range - which makes an out-of-range value genuinely informative rather than expected.Act if: Sustained IGF-1 above the age-adjusted reference range is a dose-review trigger. On the label dose in the studied population this is uncommon.
Waist circumference, or CT/MRI visceral adipose tissue areaBaseline and 26 weeks. Measure waist at the iliac crest, fasted, same time of day, same tape.This is the efficacy endpoint. Weight and BMI are actively misleading here because the compound moves the visceral compartment specifically and can leave scale weight nearly unchanged.Act if: No measurable waist change at 26 weeks on a full dose means it is not working for you, and continuing is spending money on a glucose risk for nothing.
Liver fat, by MRI proton density fat fraction or transient elastographyBaseline and 6 to 12 months, where the imaging is accessible.The hepatic fat effect is real and randomised-trial-supported, and for anyone taking this with fatty liver in mind it is the outcome that matters rather than a proxy.Act if: No specific threshold. A falling fat fraction is the confirmation that the mechanism is engaged in you specifically.
ALT and ASTBaseline, 12 weeks, 26 weeks.A cheap proxy for hepatic steatosis change when imaging is not available, and worth having as a baseline in a population where fatty liver is the reason for use.Act if: Rising transaminases on tesamorelin are not an expected effect and deserve a separate explanation.
Lipid panelBaseline and 26 weeks.Reduction in visceral adiposity was associated with an improved metabolic profile including triglycerides in the tesamorelin trials, so this is one of the few places where a favourable marker move is documented rather than hoped for.Act if: Not a stopping marker - a confirmation marker.

Pharmacokinetics

Tmax
0.15 h
Bioavailability
4%
Volume of distribution
336 L
Crosses blood-brain barrier
no
Metabolism
No formal human metabolism studies have been performed, which the label states outright. The trans-3-hexenoyl group on the N-terminal tyrosine blocks DPP-4 cleavage; beyond that, clearance is general peptidase activity.
Elimination
Not characterised in humans. Assumed proteolysis with renal handling of fragments.

Receptor targets

  • GHRH receptor (GHRHR), pituitary somatotrophFull agonist with potency comparable to native GHRH(1-44); no published Kd differential

    Gs coupling, cAMP, PKA, CREB. Pulsatile GH release preserved, with IGF-1 negative feedback intact - which is why IGF-1 rises but generally stays in range.

  • Visceral adipose tissue (indirect, via GH receptor)Not applicable

    The clinical signature. 15 to 18 percent reduction in visceral adipose tissue at 26 weeks in the phase 3 programme, with little change in subcutaneous fat.

  • Hepatic fat (indirect)Not applicable

    Reduced hepatic fat fraction in a randomised placebo-controlled trial in HIV-associated NAFLD, with corresponding changes in hepatic fibrosis and inflammation transcriptomic signatures.

  • Dipeptidyl peptidase-4 (evaded, not inhibited)The hexenoyl cap sterically blocks access to the Tyr1-Ala2 bond

    Extends functional half-life relative to native GHRH without altering receptor pharmacology.

Trials

  • Falutz et al., phase 3 randomised placebo-controlled trial of tesamorelin in HIV-infected patients with abdominal fat accumulation 3 · n=412 · 26 weeks · 2007

    Reduction in visceral adipose tissue at 26 weeks. Published in the New England Journal of Medicine in 2007. The participant figure here is the commonly cited enrolment for this study and should be treated as approximate - it was not confirmed from the abstract in this session.

  • Falutz et al., pooled analysis of two multicentre double-blind placebo-controlled phase 3 trials with safety extension 3 · 52 weeks · 2010

    Confirmed visceral adipose tissue reduction across both registration trials with 26-week safety extension data. Per the EGRIFTA SV label, mean VAT change was -18 percent versus +2 percent on placebo in study 1, and -14 percent versus -2 percent in study 2.

  • Stanley et al., effects of tesamorelin on non-alcoholic fatty liver disease in HIV - randomised, double-blind, multicentre trial 2 · 52 weeks · 2019

    Reduction in hepatic fat fraction in HIV-associated NAFLD. Published in Lancet HIV in 2019. This is the strongest evidence for the liver-fat effect and it is a proper randomised controlled trial, not an observational extrapolation.

  • Baker et al., controlled trial of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults 2 · 20 weeks · 2012

    Improved executive function on GHRH administration in both mild cognitive impairment and healthy older adults. Published in Archives of Neurology in 2012. A companion study in JAMA Neurology in 2013 showed corresponding increases in brain GABA levels by magnetic resonance spectroscopy.

What to expect, and when

Peak plasma concentration is reached in about nine minutes and the drug is essentially gone within the hour - the label reports an elimination half-life of 8 minutes in healthy subjects, which is shorter than most people assume. Injection-site erythema and itching, the most common adverse event, appear immediately and usually settle over the first few weeks with site rotation. Arthralgia, myalgia and peripheral oedema, when they occur, are early - first two to six weeks - and dose-related. Visceral fat reduction is measurable by 12 weeks and near-maximal at 26 weeks, which is the interval every trial used. Hepatic fat changes ran over 12 months in the Lancet HIV trial. After discontinuation, visceral fat returns over roughly six months.

Stacking and comparisons

The pairing that has actually become popular is tesamorelin with a GLP-1 receptor agonist: semaglutide or tirzepatide for total mass and appetite, tesamorelin for the visceral compartment specifically. Mechanistically this is coherent and the side-effect profiles do not overlap much, but there is no trial data on the combination and no reason to assume the visceral effect size holds during aggressive weight loss. The interaction the label actually flags is with corticosteroids: GH alters 11-beta-hydroxysteroid dehydrogenase type 1 activity, which converts cortisone to cortisol, so anyone on cortisone or prednisone may need their steroid dose reviewed. The same enzyme effect is why GH can unmask previously compensated adrenal insufficiency. The label also flags CYP substrates, because GH can suppress CYP-mediated metabolism - relevant for narrow-therapeutic-index drugs. Do not stack with another GHRH-receptor agonist: CJC-1295 in either form, or sermorelin, is the same receptor and adds nothing. Stacking with a GHRP is pharmacologically sensible - it is the same GHRH-plus-GHRP logic as everywhere else in this class - but it takes you off the protocol every efficacy number was generated on, and it adds the GHRP's own glucose burden to a drug that already has a labelled diabetes warning.

Against everything else in this class, tesamorelin's distinguishing feature is that it has phase 3 data and an FDA approval for a specific measurable outcome, and that outcome is regional rather than general. Against CJC-1295 with DAC: same receptor, but tesamorelin preserves pulsatility and keeps IGF-1 largely in range, whereas DAC drives sustained supraphysiological IGF-1. Tesamorelin is daily and expensive; DAC is weekly and cheap and unstudied. Against sermorelin and Mod GRF 1-29: same receptor, ten to twenty times the dose, and an actual evidence base. Against a GLP-1 agonist for fat loss: they do different jobs. GLP-1s produce far larger total weight loss including lean mass; tesamorelin produces a modest total change concentrated in the visceral compartment with lean mass preserved or slightly increased. Against exogenous GH for visceral fat: GH does reduce visceral fat but with far more insulin resistance, fluid retention and IGF-1 elevation, and without the regional selectivity being as clean.

Rough cost

$120–$8000/month. The range here is not a mistake. Branded EGRIFTA SV in the US runs into the thousands of dollars a month at cash price and is generally only accessible through insurance for the HIV lipodystrophy indication. Grey-market lyophilised tesamorelin, typically sold in 10 mg vials at roughly 60 to 130 USD, works out to roughly 120 to 300 USD a month at 1 to 2 mg daily. These are two entirely different products in terms of quality assurance and should not be price-compared as if they were the same thing. Figures are approximate and volatile.

Genuinely uncertain

  • The label reports an elimination half-life of 8 minutes in healthy subjects for EGRIFTA SV 1.4 mg, whereas the Core record and most secondary sources quote 26 to 38 minutes. The discrepancy probably reflects different formulations, doses and populations across label versions, but it is not resolved here and the shorter figure is the one that appears in the current label.
  • The 412 participant figure for the 2007 NEJM phase 3 trial is the commonly cited enrolment and was not confirmed from the primary abstract in this session.
  • No protein binding, systemic clearance or metabolism data exists - the label states explicitly that no formal metabolism studies have been done in humans.
  • All efficacy data comes from HIV-infected patients with lipodystrophy. Whether the 15 to 18 percent visceral fat reduction transfers to metabolically healthy people using it off-label for body composition has not been tested.
  • The cognition evidence used GHRH administration in older adults, not tesamorelin specifically at its labelled dose, and the trials were small. Treating this as an established nootropic indication overstates it considerably.
  • The long-term consequence of anti-tesamorelin antibodies cross-reacting with endogenous GHRH is not known beyond 52 weeks.
  • Grey-market tesamorelin identity and potency are unverified, and at 1 to 2 mg daily the cost pressure to cut product is higher than for microgram-dosed peptides.

Papers